PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01019180001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 137aa    MW: 15450.3 Da    PI: 10.7587
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01019180001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.33.2e-2659109151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                        k+i+n+  rqvtfskRr g++KKA+ +S+LCdae+a+i+fs  gkl+eyss
  GSVIVT01019180001  59 KKIDNTAARQVTFSKRRRGLFKKAQDISILCDAEIALIVFSAAGKLFEYSS 109
                        68***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.88951111IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-3651110IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-2751113IPR002100Transcription factor, MADS-box
CDDcd002656.47E-3352131No hitNo description
PRINTSPR004048.1E-275373IPR002100Transcription factor, MADS-box
PfamPF003191.2E-2360107IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-277388IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-2788109IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MLKTILCCGH CSFSIFLFLS SKQLVAGSVG FVTCPHNWKQ HRKGLVENFP MARQKIQIKK  60
IDNTAARQVT FSKRRRGLFK KAQDISILCD AEIALIVFSA AGKLFEYSSS RLVLSSLPFL  120
LFIHRYMNLS AFCRQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-1751112162Myocyte-specific enhancer factor 2B
1tqe_Q1e-1751112162Myocyte-specific enhancer factor 2B
1tqe_R1e-1751112162Myocyte-specific enhancer factor 2B
1tqe_S1e-1751112162Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.147071e-149stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4233241e-158AM423324.2 Vitis vinifera contig VV78X231511.14, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010648099.13e-35PREDICTED: MADS-box protein AGL24-like isoform X4
TrEMBLD7UBC12e-50D7UBC1_VITVI; Putative uncharacterized protein
STRINGVIT_15s0024g02000.t017e-50(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24540.13e-30AGAMOUS-like 24